Protein coding transcript 215426

• Transcript: Ll_transcript_202735
• CDS coordinates: 38-631 (+)
• Peptide sequence: MICCIILEVNYILFLFCFLVDVELDIAVTCIQFNPIDDDYFISGSLDAKVRIWNIPERHVVDWTDTHEMVTAVSYSPDGQCALVGTHKGGCRTYSTEDCKLSQTGTIEIRHKKKSQLRKVTGFQFAPGNPSEVLVTSADSRIRILSGSEVVHKFRGFRNANSQIAASFSPDGRYIISASEDSQVYVWKHEEHRSAGSG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_202735

• Blastp: WD repeat-containing protein 44 from Mus with 41.82% of identity
• Blastx: WD repeat-containing protein 44 from Bos with 41.82% of identity
• Eggnog: WD repeatcontaining protein(ENOG410XQPJ)
• Kegg: Link to kegg annotations (72404)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448589.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;