Protein coding transcript 215469

• Transcript: Ll_transcript_200476
• CDS coordinates: 1032-1466 (+)
• Peptide sequence: MTLCCMEKEDDLMLRRFLRFRDLDIEKASTMFLKYLKWRHSFVPNGSISQQEILNELAHDKVFAQGHDKSGRPIAIFCGAKHFQNKNGLEEFKRFVVYAFDKLCASMPPGQEKFFVIGDLKGWKYSNCDVRGYICALNILQLSG*
• ORF Type: complete

Annotations of Ll_transcript_200476

• Blastp: CRAL-TRIO domain-containing protein C3H8.02 from Schizosaccharomyces with 27.13% of identity
• Blastx: Pol polyprotein from Gammaretrovirus with 26.94% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC3H8.02)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432977.1)
• Pfam: CRAL/TRIO domain (PF00650.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;