Protein coding transcript 215472

• Transcript: Ll_transcript_200497
• CDS coordinates: 259-819 (+)
• Peptide sequence: MADNRTKEGGAIVQVVVDDGGVEKDSSESEITKIHLMRDFVETRDPSSKKEDDLMLRRFLRFRDLDIEKASTMFLKYLKWRHSFVPNGSISQQEILNELAHDKVFAQGHDKSGRPIAIFCGAKHFQNKNGLEEFKRFVVYAFDKLCASMPPGQEKFFVIGDLKGWKYSNCDVRGYICALNILQLSG*
• ORF Type: complete

Annotations of Ll_transcript_200497

• Blastp: Patellin-5 from Arabidopsis with 32.5% of identity
• Blastx: Pol polyprotein from Gammaretrovirus with 26.94% of identity
• Eggnog: Transfer protein(ENOG410XRSQ)
• Kegg: Link to kegg annotations (AT4G09160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432977.1)
• Pfam: CRAL/TRIO domain (PF00650.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;