| Transcript | Ll_transcript_200498 |
|---|---|
| CDS coordinates | 1032-1352 (+) |
| Peptide sequence | MTLCCMEKEDDLMLRRFLRFRDLDIEKASTMFLKYLKWRHSFVPNGSISQQEILNELAHDKVFAQGHDKSGRPIAIFCGAKHFQNKNGLEEFKRFVVYAFDKLCAR* |
| ORF Type | complete |
| Blastp | Phosphatidylinositol/phosphatidylcholine transfer protein SFH12 from Arabidopsis with 38.96% of identity |
|---|---|
| Blastx | Pol polyprotein from Gammaretrovirus with 26.94% of identity |
| Eggnog | Transfer protein(ENOG410XRSQ) |
| Kegg | Link to kegg annotations (AT4G36490) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019432977.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer