Protein coding transcript 215474

• Transcript: Ll_transcript_200501
• CDS coordinates: 1032-1475 (+)
• Peptide sequence: MTLCCMEKEDDLMLRRFLRFRDLDIEKASTMFLKYLKWRHSFVPNGSISQQEILNELAHDKVFAQGHDKSGRPIAIFCGAKHFQNKNGLEEFKRFVVYAFDKLCASMPPGQEKFFVIGDLKGWKYSNCDVRGYICALNILQLQLTRI*
• ORF Type: complete

Annotations of Ll_transcript_200501

• Blastp: CRAL-TRIO domain-containing protein C3H8.02 from Schizosaccharomyces with 27.13% of identity
• Blastx: Random slug protein 5 from Dictyostelium with 28.48% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC3H8.02)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463612.1)
• Pfam: CRAL/TRIO domain (PF00650.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;