| Transcript | Ll_transcript_200511 |
|---|---|
| CDS coordinates | 259-813 (+) |
| Peptide sequence | MADNRTKEGGAIVQVVVDDGGVEKDSSESEITKIHLMRDFVETRDPSSKKEDDLMLRRFLRFRDLDIEKASTMFLKYLKWRHSFVPNGSISQQEILNELAHDKVFAQGHDKSGRPIAIFCGAKHFQNKNGLEEFKRFVVYAFDKLCASMPPGQEKFFVIGDLKGWKYSNCDVRGYICALNILQV* |
| ORF Type | complete |
| Blastp | Patellin-5 from Arabidopsis with 32.5% of identity |
|---|---|
| Blastx | - |
| Eggnog | Transfer protein(ENOG410XRSQ) |
| Kegg | Link to kegg annotations (AT4G09160) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019463611.1) |
| Pfam | CRAL/TRIO domain (PF00650.19) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer