Transcript | Ll_transcript_200513 |
---|---|
CDS coordinates | 259-708 (+) |
Peptide sequence | MADNRTKEGGAIVQVVVDDGGVEKDSSESEITKIHLMRDFVETRDPSSKKEDDLMLRRFLRFRDLDIEKASTMFLKYLKWRHSFVPNGSISQQEILNELAHDKVFAQGHDKSGRPIAIFCGAKHFQNKNGLEEFKRMFSPTTFIHYHYA* |
ORF Type | complete |
Blastp | Patellin-5 from Arabidopsis with 32.5% of identity |
---|---|
Blastx | - |
Eggnog | Transfer protein(ENOG410XRSQ) |
Kegg | Link to kegg annotations (AT4G09160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463611.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer