Transcript | Ll_transcript_202710 |
---|---|
CDS coordinates | 246-962 (+) |
Peptide sequence | MDVFNVTGQDGNKVTDEAILDYIAKSLGPESCVTSPMRSIGMKQTMDYTAIELLGSDRPGLLSEVSAVLTNLKCNILNAEVWTHNARAAAVMHVSEETGSAIIDPQKLSLIKELLCNVLGGGNKNRGAKTVVTDEVTHTERRLHQMLFADRDYDRVNDDDFDEKQRPNVNVVNWFDKDYSVVTIQSKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQVQDLLPLCYACLWRTIC* |
ORF Type | complete |
Blastp | ACT domain-containing protein ACR4 from Arabidopsis with 67.7% of identity |
---|---|
Blastx | ACT domain-containing protein ACR4 from Arabidopsis with 65.5% of identity |
Eggnog | ACT domain(ENOG410Y95G) |
Kegg | Link to kegg annotations (AT1G69040) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433430.1) |
Pfam | ACT domain (PF01842.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer