Protein coding transcript 215571

• Transcript: Ll_transcript_202712
• CDS coordinates: 224-664 (+)
• Peptide sequence: MPVMHFLVYFLHQPYLRLVFIVYNKTTNLFFYLFLIQGLMLELCTTDRVGLLSDVTRIFRENSLTVTRAEVTTKGGKAVNTFYVRGASACIVDSKTIESIRQAIGNTILQVKGCPDESKSVPQNSQTRSLFSGLFKSRSFVNFGLV*
• ORF Type: complete

Annotations of Ll_transcript_202712

• Blastp: ACT domain-containing protein ACR5 from Arabidopsis with 75.45% of identity
• Blastx: ACT domain-containing protein ACR4 from Arabidopsis with 72.03% of identity
• Eggnog: ACT domain(ENOG41105EI)
• Kegg: Link to kegg annotations (AT2G03730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428483.1)
• Pfam: ACT domain (PF01842.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;