| Transcript | Ll_transcript_202715 |
|---|---|
| CDS coordinates | 2-319 (+) |
| Peptide sequence | FIPKTLTKPFRQNFGLAHHKSSAPVMAFMSEVNMNSFPHYMDDEYEKLFRRVNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAYISSDGGW |
| ORF Type | internal |
| Blastp | ACT domain-containing protein ACR4 from Arabidopsis with 83.1% of identity |
|---|---|
| Blastx | ACT domain-containing protein ACR4 from Arabidopsis with 83.1% of identity |
| Eggnog | ACT domain(ENOG410Y95G) |
| Kegg | Link to kegg annotations (AT1G69040) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_014523558.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer