Protein coding transcript 215585

• Transcript: Ll_transcript_202702
• CDS coordinates: 716-1324 (+)
• Peptide sequence: MRSIGMKQTMDYTAIELLGSDRPGLLSEVSAVLTNLKCNILNAEVWTHNARAAAVMHVSEETGSAIIDPQKLSLIKELLCNVLGGGNKNRGAKTVVTDEVTHTERRLHQMLFADRDYDRVNDDDFDEKQRPNVNVVNWFDKDYSVVTIQSKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQVQDLLPLCYACLWRTIC*
• ORF Type: complete

Annotations of Ll_transcript_202702

• Blastp: ACT domain-containing protein ACR4 from Arabidopsis with 66.32% of identity
• Blastx: ACT domain-containing protein ACR5 from Arabidopsis with 61.78% of identity
• Eggnog: ACT domain(ENOG410Y95G)
• Kegg: Link to kegg annotations (AT1G69040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433429.1)
• Pfam: ACT domain (PF01842.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;