Protein coding transcript 215631

• Transcript: Ll_transcript_201221
• CDS coordinates: 1222-1830 (+)
• Peptide sequence: MDSPSVISNPITNTDRSRDSKRRKKNKSQLRHQHQHSNSPIKWKSQEQQQIYSSKLHQSLTTSSPPCGGKAVREAADRVLAATAKGRTRWSRAIITNRLKLKFRKQHKRKRVVSSSTLSNRSKKQTRFSVLRLRGKTVPAFQNKVKVLARLVPGCRKEPLAVILEEAIDYIPALEMQVRAMTALYQLLFASSSGGAATFGPL*
• ORF Type: complete

Annotations of Ll_transcript_201221

• Blastp: Transcription factor bHLH147 from Arabidopsis with 55.62% of identity
• Blastx: Transcription factor bHLH147 from Arabidopsis with 55.62% of identity
• Eggnog: Transcription factor(ENOG410YRF4)
• Kegg: Link to kegg annotations (AT3G17100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464807.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;