Transcript | Ll_transcript_201222 |
---|---|
CDS coordinates | 3-386 (+) |
Peptide sequence | ADRLLAVTAKGRTRWSRAILTNRLKLKFRKQHKRKRVVYSSTESERFKKQTRFNVLGLKGKTVPDFERKVKVLGRLVPGCRKEPLAVILEEAIDYIPALEMQVRAMTALYQLLFASSSGGAATFGPL* |
ORF Type | 5prime_partial |
Blastp | Transcription factor bHLH148 from Arabidopsis with 57.81% of identity |
---|---|
Blastx | Transcription factor bHLH148 from Arabidopsis with 57.81% of identity |
Eggnog | Transcription factor(ENOG410YRF4) |
Kegg | Link to kegg annotations (AT3G06590) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424706.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer