Protein coding transcript 215646

• Transcript: Ll_transcript_200140
• CDS coordinates: 3-542 (+)
• Peptide sequence: SCWAFATIAAVEGINKLVTGELISLSEQELVDCDKSYNQGCNGGVMDYAFEFIVNNGGIDSESDYPYKGVDGTCDQYRKNSKVVVIDEYEDVPAYDEKALQKAVANQPVANAVEGGGREFQLYESGIFTGKCGPALDHGVNTVGYGTENGNDYWLVRNSWGPSWGEDGYIRFERNLASSK
• ORF Type: internal

Annotations of Ll_transcript_200140

• Blastp: Cysteine proteinase RD21A from Arabidopsis with 74.86% of identity
• Blastx: Cysteine proteinase RD21A from Arabidopsis with 74.86% of identity
• Eggnog: cathepsin(COG4870)
• Kegg: Link to kegg annotations (AT1G47128)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447132.1)
• Pfam: Papain family cysteine protease (PF00112.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;