Transcript | Ll_transcript_200131 |
---|---|
CDS coordinates | 298-981 (+) |
Peptide sequence | MFSYCLESIFTRILCFLFCQGIFTGKCGTALDHGVNAVGYGTENGKDYWIVRNSWGPNWGENGYIRLERNIASSRAGKCGIAIEPSYPVKNGQNPPKPGPSPPTPVQPPSVCDNDYSCPQSTTCCCIFEFGNSCFAWGCCPLEGATCCDDHYSCCPHEYPICNVNAGTCLRSKNNPFWSESIEANSGSAPHFSRKWERDKQCLSCLSKCVRAERADDEFKEGEGLQH* |
ORF Type | complete |
Blastp | Oryzain alpha chain from Oryza sativa with 73.65% of identity |
---|---|
Blastx | Oryzain alpha chain from Oryza sativa with 73.65% of identity |
Eggnog | cathepsin(COG4870) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436931.1) |
Pfam | Papain family cysteine protease (PF00112.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer