Transcript | Ll_transcript_200062 |
---|---|
CDS coordinates | 461-877 (+) |
Peptide sequence | MQTEARVGVAVDGGVRKLVQPQKKQVGTVSQLLAGGVAGALSKTCTAPLARLTILFQIQGMHSNVATLRKASMWNEASRIIHEEGFRAFWKGNLVTIAHRLPYSSVNFYSYEHYKKVSGITTRDIFISVKLSYRESCI* |
ORF Type | complete |
Blastp | Calcium-binding mitochondrial carrier protein SCaMC-1 from Homo with 37.62% of identity |
---|---|
Blastx | Mitochondrial substrate carrier family protein B from Dictyostelium with 51.39% of identity |
Eggnog | Solute carrier family 25 (Mitochondrial carrier(ENOG410XQ4P) |
Kegg | Link to kegg annotations (29957) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433219.1) |
Pfam | Mitochondrial carrier protein (PF00153.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer