Protein coding transcript 215686

• Transcript: Ll_transcript_200075
• CDS coordinates: 461-1093 (+)
• Peptide sequence: MQTEARVGVAVDGGVRKLVQPQKKQVGTVSQLLAGGVAGALSKTCTAPLARLTILFQIQGMHSNVATLRKASMWNEASRIIHEEGFRAFWKGNLVTIAHRLPYSSVNFYSYEHYKKLLKMVPGLKSHRDKASSDLCVHFVGGGLAGITASTSTYPLDLVRTRLAAQGNVIYYRGIWHALQTIVREEGVLGLYKGLGTTLLVCCYYQFKIT*
• ORF Type: complete

Annotations of Ll_transcript_200075

• Blastp: Mitochondrial substrate carrier family protein B from Dictyostelium with 40.34% of identity
• Blastx: Calcium-binding mitochondrial carrier protein SCaMC-1 from Silurana with 30.04% of identity
• Eggnog: Solute carrier family 25(ENOG410ZRF1)
• Kegg: Link to kegg annotations (DDB_G0285599)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433219.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;