Protein coding transcript 215695

• Transcript: Ll_transcript_200064
• CDS coordinates: 151-507 (+)
• Peptide sequence: MYFIASIRLILLSVYIRSDDSTVVVSLACGSLSGIASSTTTFPLDLVRRRKQLEGACGRARVYNMGLFGVFRQIIRTEGARGLYRGILPEYYKVVPGVGICFMTYETLKMLLADIGSA*
• ORF Type: complete

Annotations of Ll_transcript_200064

• Blastp: Mitochondrial substrate carrier family protein B from Dictyostelium with 46.6% of identity
• Blastx: Mitochondrial substrate carrier family protein B from Dictyostelium with 46.6% of identity
• Eggnog: Solute carrier family 25(ENOG410ZRF1)
• Kegg: Link to kegg annotations (DDB_G0285599)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461199.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;