Protein coding transcript 215711

• Transcript: Ll_transcript_202776
• CDS coordinates: 277-639 (+)
• Peptide sequence: MASLAASTAVGSLGRSEMLGNSINLSGATRSLSSPSNPSAFKTVAFFSNFTKKKAAPPPPKQKAAAVSPATDELAKWYGPDRRIFLPDGLLDRSEIPEYLTGEVAGEYVASSLIVPFNLH*
• ORF Type: complete

Annotations of Ll_transcript_202776

• Blastp: Chlorophyll a-b binding protein CP26, chloroplastic from Arabidopsis with 57% of identity
• Blastx: Chlorophyll a-b binding protein CP26, chloroplastic from Arabidopsis with 53.23% of identity
• Eggnog: Chlorophyll A-B binding protein(ENOG41110WY)
• Kegg: Link to kegg annotations (AT4G10340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449441.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;