Protein coding transcript 215716

• Transcript: Ll_transcript_202782
• CDS coordinates: 267-776 (+)
• Peptide sequence: MAGSLGMSKMLGNPINLSGATRAVPSPSNSSTFKTVAFFNFNNKKTAPSPKQKPSAVVSNADDELAKWYGPDRRIFLPDGLLDRSEIPAYLTGEVAGDYGYDPFGLGKKPEDFAKYQANELIQGRWAMLGAAGFIIPEAFNKYGANCGPEAVWFKVCKLYNKLPSLLIH*
• ORF Type: complete

Annotations of Ll_transcript_202782

• Blastp: Chlorophyll a-b binding protein CP26, chloroplastic from Arabidopsis with 69.43% of identity
• Blastx: Chlorophyll a-b binding protein CP26, chloroplastic from Arabidopsis with 69.43% of identity
• Eggnog: Chlorophyll A-B binding protein(ENOG41110WY)
• Kegg: Link to kegg annotations (AT4G10340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413911.1)
• Pfam: Chlorophyll A-B binding protein (PF00504.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;