Transcript | Ll_transcript_202765 |
---|---|
CDS coordinates | 277-639 (+) |
Peptide sequence | MASLAASTAVGSLGRSEMLGNSINLSGATRSLSSPSNPSAFKTVAFFSNFTKKKAAPPPPKQKAAAVSPATDELAKWYGPDRRIFLPDGLLDRSEIPEYLTGEVAGEYVASSLIVPFNLH* |
ORF Type | complete |
Blastp | Chlorophyll a-b binding protein CP26, chloroplastic from Arabidopsis with 57% of identity |
---|---|
Blastx | Chlorophyll a-b binding protein CP26, chloroplastic from Arabidopsis with 90.3% of identity |
Eggnog | Chlorophyll A-B binding protein(ENOG41110WY) |
Kegg | Link to kegg annotations (AT4G10340) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449441.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer