Protein coding transcript 215735

• Transcript: Ll_transcript_202032
• CDS coordinates: 751-1167 (+)
• Peptide sequence: MSENSAFPDTNQGNDLNRKNQVEDKGVSSKIVSGGARDMDKDAQNIETSGSDTSSAKGKNVMDHTDNGELSKSNELLKKARVEENPDDEKVETVQRRKRKRNIMNDKQVSLIETALLDEPDMHRNSASLQSWADKLSSH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_202032

• Blastp: Nodulin homeobox from Arabidopsis with 50% of identity
• Blastx: Nodulin homeobox from Arabidopsis with 35.55% of identity
• Eggnog: HOX(ENOG410XTJ0)
• Kegg: Link to kegg annotations (AT4G03090)
• CantataDB: Link to cantataDB annotations (CNT0002267)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436230.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;