Protein coding transcript 215743

• Transcript: Ll_transcript_202018
• CDS coordinates: 780-1478 (+)
• Peptide sequence: MGFVQLNAMRLADIFSDDSNFRSYMILCFTKVLTAVISLSHGDFLSFWCSSSLPETEEDATLEYDIFAAVGWVLDNTSLDIRNTMNLEFNLIPNSMPKASYAHHRTSLFVKFFANLHCFVPSICVEQERNLFILKVMECLQMDLSSLLPGCSFAPDDASKAATASKNLCNDCSMYSFLWNDEIYITTFLQVTSFCRLIVKSCRIFDSKFFKRRGYSDFKVIFPLFLLWCSVL*
• ORF Type: complete

Annotations of Ll_transcript_202018

• Blastp: Nodulin homeobox from Arabidopsis with 46.5% of identity
• Blastx: Nodulin homeobox from Arabidopsis with 42.15% of identity
• Eggnog: HOX(ENOG410XTJ0)
• Kegg: Link to kegg annotations (AT4G03090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436230.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;