Protein coding transcript 215762

• Transcript: Ll_transcript_202582
• CDS coordinates: 217-714 (+)
• Peptide sequence: MADPLLQGHYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLASQTYDPNAPNQSNRLGGPSTPRSKDARRNMGDGMDSPDHGRLGSPSTHRNSPDYRKRNSRDPGSGTELGRSVSNGGSGRKWGLDEVERQESQRDSPANSGRGRETARNRDLDRERAVAE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_202582

• Blastp: Serine/threonine-protein kinase PBL27 from Arabidopsis with 68.79% of identity
• Blastx: Serine/threonine-protein kinase PBL27 from Arabidopsis with 70.97% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G18610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439713.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;