Protein coding transcript 215770

• Transcript: Ll_transcript_202560
• CDS coordinates: 271-816 (+)
• Peptide sequence: MGRCFPCFGSSNKEGKKNGVKEVVAKKESFKDASIPQSQYPTRVSSDKSKSQSGSDPKKEIPVAKNGPTAHIAAQTFTFRELAVATKNFRPECLLGEGGFGRVYKGRLENTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVKLIGYCADGDQRLLVYEFMPLGSLEDRLHGKTSL*
• ORF Type: complete

Annotations of Ll_transcript_202560

• Blastp: Serine/threonine-protein kinase PBL27 from Arabidopsis with 75.57% of identity
• Blastx: Serine/threonine-protein kinase PBL27 from Arabidopsis with 73.86% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G18610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439715.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;