Protein coding transcript 215790

• Transcript: Ll_transcript_200823
• CDS coordinates: 145-651 (+)
• Peptide sequence: MEEIIKGDLVTRIQAVKQKSGKSYNQIAEETGLTNVYVAQLLRRQAQLKPETAPKLRAALPDLTEELLIQMVKPPLRSYDPNLIQDPTVYRLNEAVMHFGESIKEIINEEFGDGIMSAIDFYCSVDKVKGVDGKDRVVLTFDGKYLPYTEQKSEDMVSVSRIRPQGNQ*
• ORF Type: complete

Annotations of Ll_transcript_200823

• Blastp: Cyanate hydratase from Medicago with 83.02% of identity
• Blastx: Cyanate hydratase from Medicago with 83.02% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_1g041795)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449957.1)
• Pfam: Cyanate lyase C-terminal domain (PF02560.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;