Protein coding transcript 21594

• Transcript: Ll_transcript_319401
• CDS coordinates: 2-709 (+)
• Peptide sequence: DLTSGLEVSPSTNNADGDASSGYSNRSVLTIAFQFPFDSSLQDNIALMAIQYVRSVICSVQRIAMAISPPGINPAISAKSSPGSPEALTLAHWICQSYSYHFGMELLRSDTLVGDSMLKHLWHHHDAILCCSLKSLPVFVFANQAGLDMMETTLVALQDITLDKIFDESGRKAFFADFAKLMQQGFAYVPSGMCMSTMGRHVSYEQAIAWKVFGEGDNNNNVHCLAFSFINWSFL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_319401

• Blastp: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 72.15% of identity
• Blastx: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 72.15% of identity
• Eggnog: Homeobox-leucine zipper protein(ENOG410ZJBV)
• Kegg: Link to kegg annotations (AT5G60690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458095.1)
• Pfam: MEKHLA domain (PF08670.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;