Protein coding transcript 21596

• Transcript: Ll_transcript_319414
• CDS coordinates: 428-1423 (+)
• Peptide sequence: MSTTVQKTPRSGRQSLFFKDLASPVSTRRGKFSSPGQAAPVSTPWRENFGGSDLPPPPFYTLEDRSDFSPESGIPDYQVSPETKSDPRSPMQSSNTEFSTPLKNKSEASTSYALRGVQQNHQDSPGLNWWSPVPAKSGSEQDDKATSSPVEGVIQPGALITLPPPLEVARPEVKRNSFPAGNLIEEEWVTVYGFSPYDTNLVLREFEKCGEILKHVPGPRDANWIHILYQNRSDAQKALNKNGMQINGVLIVGVKPLDPMQRQSLNERQNNQEFMPLPLSSARISETSTLRASSRPYYLQNGNSAVRQAGGTIASPTKSLVSKVMDLMFGV*
• ORF Type: complete

Annotations of Ll_transcript_319414

• Blastp: Nuclear pore complex protein NUP35 from Arabidopsis with 69.58% of identity
• Blastx: Nuclear pore complex protein NUP35 from Arabidopsis with 69.58% of identity
• Eggnog: nucleoporin(ENOG4111ARE)
• Kegg: Link to kegg annotations (AT3G16310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458803.1)
• Pfam: Nup53/35/40-type RNA recognition motif (PF05172.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;