Protein coding transcript 215976

• Transcript: Ll_transcript_202356
• CDS coordinates: 236-1006 (+)
• Peptide sequence: MPVARRETSDCRVIGHVDMDCFYVQVEQRKEPKLRGVPTAVVQYNSYKGGGLIAVSYEARAHGVKRSMRGDEAKEACPQIQLVQVPVARGKADLNTYRSAGSEVVSILSRKGRCERASIDEVYLDLTDAAEAMFMETPPESMEDIQEEVTKSHVLGLQFEDGNDPKEEVRKWLCRSDASYQDKLLACAAFIIADLRMQVLKETEFTCSAGIAHNKMLAKLASAMNKPAQQTVVPHSSVAGNSLGENWEVPYKVILV*
• ORF Type: complete

Annotations of Ll_transcript_202356

• Blastp: DNA polymerase eta from Arabidopsis with 78.15% of identity
• Blastx: DNA polymerase eta from Arabidopsis with 78.15% of identity
• Eggnog: Poorly processive error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by polIV. Exhibits no 3-5 exonuclease (proofreading) activity. May be involved in translesional synthesis in conjunction with the beta clamp from polIII (By similarity)(COG0389)
• Kegg: Link to kegg annotations (AT5G44740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459921.1)
• Pfam: impB/mucB/samB family (PF00817.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;