Transcript | Ll_transcript_201524 |
---|---|
CDS coordinates | 413-1258 (+) |
Peptide sequence | MLEGLEEEGYSIEETGHHSEKKRRLRVDQVKALEKKFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARYKTKLLERDYCVLKASYDALKLNYDTLQKDNSALLKEIKELKSRVEEENNESDASVKEEMITLQQDSSEDLKYDCFNKKNNEGVGAGTLFSIDFDKDGASDSDFSATLNEEQNNNSPNYNPAISSSGVLQSHNFLMSPVLKFNNCSSLSSPSSMNCFQFQKANCYQARYVKMEERDFFSADEACNFFSDEQAPTLQWDCSEEWSQANKQ* |
ORF Type | complete |
Blastp | Homeobox-leucine zipper protein ATHB-16 from Arabidopsis with 45.42% of identity |
---|---|
Blastx | Homeobox-leucine zipper protein ATHB-16 from Arabidopsis with 43.31% of identity |
Eggnog | homeobox-leucine zipper protein(ENOG410Z2UE) |
Kegg | Link to kegg annotations (AT4G40060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462051.1) |
Pfam | Homeobox domain (PF00046.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer