| Transcript | Ll_transcript_201525 |
|---|---|
| CDS coordinates | 586-1017 (+) |
| Peptide sequence | MITLQQDSSEDLKYDCFNKKNNEGVGAGTLFSIDFDKDGASDSDFSATLNEEQNNNSPNYNPAISSSGVLQSHNFLMSPVLKFNNCSSLSSPSSMNCFQFQKANCYQARYVKMEERDFFSADEACNFFSDEQAPTLQWYCSDF* |
| ORF Type | complete |
| Blastp | Homeobox-leucine zipper protein ATHB-6 from Arabidopsis with 54.05% of identity |
|---|---|
| Blastx | - |
| Eggnog | homeobox-leucine zipper protein(ENOG410Z2UE) |
| Kegg | Link to kegg annotations (AT2G22430) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019462051.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer