Protein coding transcript 216090

• Transcript: Ll_transcript_201536
• CDS coordinates: 413-1237 (+)
• Peptide sequence: MLEGLEEEGYSIEETGHHSEKKRRLRVDQVKALEKKFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARYKTKLLERDYCVLKASYDALKLNYDTLQKDNSALLKEIKELKSRVEEENNESDASVKEEMITLQQDSSEDLKYDCFNKKNNEGVGAGTLFSIDFDKDGASDSDFSATLNEEQNNNSPNYNPAISSSGVLQSHNFLMSPVLKFNNCSSLSSPSSMNCFQFQKANCYQARYVKMEERDFFSADEACNFFSDEQAPTLQWYCSDF*
• ORF Type: complete

Annotations of Ll_transcript_201536

• Blastp: Homeobox-leucine zipper protein ATHB-16 from Arabidopsis with 45.86% of identity
• Blastx: Homeobox-leucine zipper protein ATHB-16 from Arabidopsis with 43.69% of identity
• Eggnog: homeobox-leucine zipper protein(ENOG410Z2UE)
• Kegg: Link to kegg annotations (AT4G40060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462051.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;