Protein coding transcript 2161

• Transcript: Ll_transcript_534254
• CDS coordinates: 3-347 (+)
• Peptide sequence: PFAINGCPLRRVHPNFLIATQTKLDISSVTLPEKINDDYFKRQRVKRAKKEEGEIFAKKAEKYTPSEERKSDQDAVDKQMLAIIKKHPEKKMLASYLRNMFGLRSNQYPHRLKF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_534254

• Blastp: 60S ribosomal protein L6 from Caenorhabditis with 50.88% of identity
• Blastx: 60S ribosomal protein L6 from Caenorhabditis with 50.88% of identity
• Eggnog: (ribosomal) protein(COG2163)
• Kegg: Link to kegg annotations (CELE_R151.3)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004504017.1)
• Pfam: Ribosomal protein L6e (PF01159.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;