Protein coding transcript 21620

• Transcript: Ll_transcript_319913
• CDS coordinates: 346-684 (+)
• Peptide sequence: MFILGFSLFMAFSVPQYFNEYEYEYPWLPGHGPLHTHSTAFNNIVQVIFSSPATVAIIVAYFLDSTLSRGHSSTRRDSGRHWWEKFRNFNQDTRSDEFYSLPWNLNRFFPSH*
• ORF Type: complete

Annotations of Ll_transcript_319913

• Blastp: Nucleobase-ascorbate transporter 4 from Arabidopsis with 63.64% of identity
• Blastx: Nucleobase-ascorbate transporter 4 from Arabidopsis with 65.38% of identity
• Eggnog: permease(COG2233)
• Kegg: Link to kegg annotations (AT1G49960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426770.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;