Transcript | Ll_transcript_534194 |
---|---|
CDS coordinates | 1-417 (+) |
Peptide sequence | LAAQLQQQNQQLFSYKMASSFQNPAAAVSSSSYDLGTVNTINTSIAGQLQHQAQQVQKSGHLVQQQNNQWWNTPGMPNPPSVNYQNVNTNLQQQQVMNRGKMPKKDAKPRGRMTAYAFFVQTCREEHKKQHPDENVVFA |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | High mobility group protein DSP1 from Sophophora with 86.11% of identity |
Eggnog | high mobility group(COG5648) |
Kegg | Link to kegg annotations (Dmel_CG12223) |
CantataDB | - |
Mirbase | - |
Ncbi protein | - |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer