Protein coding transcript 21643

• Transcript: Ll_transcript_318937
• CDS coordinates: 1666-2277 (+)
• Peptide sequence: MTAAQALNHPWIKNYKDVKVPLDILIFKLMKAYMHSSSLRKTALRALSKTLTVDELFYMKEQFALLEPNENGTVSLENIKAALMKNATNAMKETRIPDLLASLNALQHKRMDFDEFCAAALSVHQLEALDRWEQHARCAYELFEKDGNRAIVIEELASELCLGPSVPVHSVLHDWIRHTDGKLSFLGFVKLLHGPSRSLSKAQ*
• ORF Type: complete

Annotations of Ll_transcript_318937

• Blastp: CDPK-related protein kinase from Daucus sect. Daucus with 80.88% of identity
• Blastx: CDPK-related protein kinase from Daucus sect. Daucus with 82.66% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422354.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;