Protein coding transcript 21644

• Transcript: Ll_transcript_318938
• CDS coordinates: 149-538 (+)
• Peptide sequence: MTTAIAIEDVRREVKILRALTGHKNLVQFYDAYEDHDNVYIVMELCEGGELLDRILSRGGKYTEEDAKFVLRQILDVVAFCHLQGVVHRDLKPENFLFTSKDENSELKAIDFGLSDFVKPNERLNDIVGS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_318938

• Blastp: CDPK-related protein kinase from Daucus sect. Daucus with 89.23% of identity
• Blastx: CDPK-related protein kinase from Daucus sect. Daucus with 89.23% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422352.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;