Transcript | Ll_transcript_153986 |
---|---|
CDS coordinates | 200-517 (+) |
Peptide sequence | MAGFLISSHSCTVCSQGLISGSAELREQAAIGLGELIEVTSEQSLKAFVIPITGPLIRIIGDRFPWQVKSAILSTLTIMIRKGGISLKPFLPQLQTTFVKCLQDST |
ORF Type | 3prime_partial |
Blastp | Protein ILITYHIA from Arabidopsis with 90.11% of identity |
---|---|
Blastx | Protein ILITYHIA from Arabidopsis with 90.11% of identity |
Eggnog | GCN1 general control of amino-acid synthesis 1-like 1 (Yeast)(ENOG410XPSD) |
Kegg | Link to kegg annotations (AT1G64790) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420929.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer