Protein coding transcript 216497

• Transcript: Ll_transcript_154657
• CDS coordinates: 2-574 (+)
• Peptide sequence: EEEEEEEAEEEEEEEEEEGNEIDVEENQDQQQQQEVKGRKVDSKGLHSVLGTPPKILLPSGSGIPLPDKRTLELILDKLQKKDTYGVYAEPVDPEELPDYHDVIDHPMDFATVRKKLENGSYPTLEQFEVCKYVSVVHDWCCWKFLFLGFGYFCTAILLGLHVVTMHFCFFSLNGRKCAIHYLHLTLRLN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_154657

• Blastp: Bromodomain-containing protein 1 from Homo with 53.45% of identity
• Blastx: Bromodomain-containing protein 1 from Homo with 53.45% of identity
• Eggnog: bromodomain(COG5076)
• Kegg: Link to kegg annotations (23774)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435601.1)
• Pfam: Bromodomain (PF00439.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;