| Transcript | Ll_transcript_156382 |
|---|---|
| CDS coordinates | 140-622 (+) |
| Peptide sequence | MGIPWDDVVVIQHGKDDNDPTMVTVNCPDKAGLGCDLCRITLEFGLHITRADISTDGRWCYNIFWVIPNPSSVKVDWERLKNRLLSACPSCLFSYHLNLQPTTPLPPLVYLLKVWCVDQKGLLHDITEILCNLQLLIQKVKVMPTPDGRALDLFFITDGM* |
| ORF Type | complete |
| Blastp | ACT domain-containing protein ACR9 from Arabidopsis with 65.62% of identity |
|---|---|
| Blastx | ACT domain-containing protein ACR9 from Arabidopsis with 65.62% of identity |
| Eggnog | ACT domain containing protein, expressed(ENOG410YUMM) |
| Kegg | Link to kegg annotations (AT2G39570) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019419329.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer