Protein coding transcript 216571

• Transcript: Ll_transcript_156395
• CDS coordinates: 633-1442 (+)
• Peptide sequence: MNNLGRELVLCNCSLSSVYSFSLFFYTFFLLLRSSPLKVKEDDEVDSLDIKLDVKKKSKRVYQSPTPEVGLKISRSLKSLNAKTGLFSNHMKIIHQDPMLQAQRVAAIKKAKGTVAARKHTSKTMKAFFSDPINRLKRSIAMKGVKFYCQHCGREGHRRHYCPEIKGSLIRWQYACRLCGGKGHNRRTCINSRISHTGGSVKKQYRCKICHRYGHNRRACPQVVSNKRRDLASQRTYKCRLCHKEGHNSRTCPSRTVVAEHSQEEQSMN*
• ORF Type: complete

Annotations of Ll_transcript_156395

• Blastp: DNA-binding protein HEXBP from Leishmania with 33.96% of identity
• Blastx: DNA-binding protein HEXBP from Leishmania with 33.96% of identity
• Eggnog: zinc finger(COG5082)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446859.1)
• Pfam: Zinc knuckle (PF14392.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;