Transcript | Ll_transcript_154226 |
---|---|
CDS coordinates | 939-1331 (+) |
Peptide sequence | MAVHDDCKLRFMELKAKRTYRFIVYKIEDKQVIVEKLGEPTQGYEDFTASLPADECRYAVYDFEYLTEGNVPKSRIFFIGWSPDTSRVRSKMIYASSKDRFKRELDGIQIELQATDPTEMGLDVFKSRAN* |
ORF Type | complete |
Blastp | Actin-depolymerizing factor 2 from Petunia with 83.33% of identity |
---|---|
Blastx | Actin-depolymerizing factor 2 from Petunia with 84.06% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425470.1) |
Pfam | Cofilin/tropomyosin-type actin-binding protein (PF00241.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer