Protein coding transcript 216662

• Transcript: Ll_transcript_154573
• CDS coordinates: 1-498 (+)
• Peptide sequence: EKANISFPESDIGSLQVIKNSDLEELIKLGSGTFGTVYHGKWRGTDIAIKRINDRCFSGKPSEQDRMRDDFWNEAVKLADLHHPNVVAFYGVVLDGPGGSVATVTEYMVNGSLRNALQKNGRNLDKRKRLLIAMDAAFGMEYLHGKNIVHFDLKSDNLLVNLRDPH
• ORF Type: internal

Annotations of Ll_transcript_154573

• Blastp: Probable serine/threonine-protein kinase SIS8 from Arabidopsis with 42.65% of identity
• Blastx: Probable serine/threonine-protein kinase SIS8 from Arabidopsis with 42.65% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G73660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415476.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;