Transcript | Ll_transcript_155286 |
---|---|
CDS coordinates | 245-553 (+) |
Peptide sequence | MDRVRDLASKKAAVIFTKSSCCMCHSIKQLFYELGASPAVHELDNESYGREMEWALRSLGCHPSVPAVFIGGRFVGTSKDVISLHVDGSLKQMLKDAKAIWF* |
ORF Type | complete |
Blastp | Glutaredoxin-C11 from Arabidopsis with 77.67% of identity |
---|---|
Blastx | Glutaredoxin-C11 from Arabidopsis with 77.67% of identity |
Eggnog | Glutaredoxin(COG0695) |
Kegg | Link to kegg annotations (AT3G62950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439136.1) |
Pfam | Glutaredoxin (PF00462.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer