Protein coding transcript 216779

• Transcript: Ll_transcript_156307
• CDS coordinates: 367-831 (+)
• Peptide sequence: MCDAYTPAGEPIPTNKRHRAAEIFSNPKVQAEIPWYGIEQEYTLLQTHVNWPLGWPVGGYPGPQGPYYCSAGADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILEVIHFTYFWFIYAVRPYAERLSF*
• ORF Type: complete

Annotations of Ll_transcript_156307

• Blastp: Glutamine synthetase leaf isozyme, chloroplastic from Pisum with 94.78% of identity
• Blastx: Glutamine synthetase leaf isozyme, chloroplastic from Phaseolus with 93.97% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002361)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425876.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;