| Transcript | Ll_transcript_156297 |
|---|---|
| CDS coordinates | 22-300 (+) |
| Peptide sequence | MVGSCDGMLCFAGSLNTALLWNPTIRVFKRLPPLEKYTIFGFGFDQCSDSYKVVAISNNVCSNDGGSICVPEVKIHNLGTDSWRRIQEYPYGI |
| ORF Type | 3prime_partial |
| Blastp | F-box/kelch-repeat protein At3g23880 from Arabidopsis with 32.67% of identity |
|---|---|
| Blastx | F-box/kelch-repeat protein At3g23880 from Arabidopsis with 32.67% of identity |
| Eggnog | F-box Kelch-repeat protein(ENOG410Z2HM) |
| Kegg | Link to kegg annotations (AT3G23880) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019439762.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer