Protein coding transcript 216784

• Transcript: Ll_transcript_156299
• CDS coordinates: 2-658 (+)
• Peptide sequence: SHGHNNEPATIPDGDSLHAPSPFLPFELITEILYRVPVKFLIQFKCVCKSWKTLISNPEFAQKHLSTVHHRHHLLLSINDALDNLIVRSYSLPSIFEASPPISNQVSYPLNTKNCFNFMVGSCDGMLCFAVNLDCALLWNPTIRVFKMLPPLKMYTIFGFGFDQCSDSYKVVAISNNVCSNDGGSICVPEVKIHNLGTDSWRRIQEYPYGIPTGLSAKF
• ORF Type: internal

Annotations of Ll_transcript_156299

• Blastp: F-box/kelch-repeat protein At3g23880 from Arabidopsis with 32.84% of identity
• Blastx: F-box/kelch-repeat protein At3g23880 from Arabidopsis with 32.84% of identity
• Eggnog: F-box Kelch-repeat protein(ENOG410Z2HM)
• Kegg: Link to kegg annotations (AT3G23880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439762.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;