Protein coding transcript 216785

• Transcript: Ll_transcript_156300
• CDS coordinates: 1-762 (+)
• Peptide sequence: MAIKSVDSTINRIEGLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSSTGQALGEDSEVILYPQAIFRDPFRGGNHILVICDSYTPAGEPIPTNKRYKAAEIFSNPKVQAEIPWYGIEQEYTLLQPNVKWPLGWPIGGYPGPQGPYYCSAGADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILEVIHFTYFWFIYAVRPYAERLSF*
• ORF Type: complete

Annotations of Ll_transcript_156300

• Blastp: Glutamine synthetase leaf isozyme, chloroplastic from Phaseolus with 90.13% of identity
• Blastx: Glutamine synthetase leaf isozyme, chloroplastic from Phaseolus with 90.13% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (PHAVU_006G155800g)
• CantataDB: Link to cantataDB annotations (CNT0002361)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439764.1)
• Pfam: Glutamine synthetase, beta-Grasp domain (PF03951.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;