Protein coding transcript 2169

• Transcript: Ll_transcript_534236
• CDS coordinates: 1045-1482 (+)
• Peptide sequence: MVGFVPRMHWLDKKQSNVAHYRYGGWWSVWWMGTYSMVLSKAAFFHRKYLDLYTYEMSPSIHNYISRERNCEDISMSLVVANATVAPPIWVKGKIHEIGESGISNLRGNSHNRNKCLNDLISLYGTLPLVSTNVKAVSGRNEWLW*
• ORF Type: complete

Annotations of Ll_transcript_534236

• Blastp: Glycosyltransferase family 64 protein C4 from Arabidopsis with 58.62% of identity
• Blastx: Glycosyltransferase family 64 protein C4 from Arabidopsis with 57.58% of identity
• Eggnog: exostoses (multiple)-like 2(ENOG410XQYV)
• Kegg: Link to kegg annotations (AT3G55830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449409.1)
• Pfam: Glycosyl transferase family 64 domain (PF09258.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;