Protein coding transcript 216923

• Transcript: Ll_transcript_154706
• CDS coordinates: 2208-2765 (+)
• Peptide sequence: MQHQIIFSPLLLLQGVGVLYAAYRLIEKIVLLLYSGDVSRTYTSIASKSRDCFGFFHHGSRLLGWWSIDERSREEEARLYCAENSGYNTFSPDTVKRMPRTDLVDEIWRLQAALGEQTEVTKYSQEQYERLQNEKILCRVCFEEQINVVLLPCRHHIICSTCSEKCKRCPVCRVMIEEPLVVYDM*
• ORF Type: complete

Annotations of Ll_transcript_154706

• Blastp: Kinesin-like protein KIN-7D, mitochondrial from Arabidopsis with 36.36% of identity
• Blastx: Kinesin-like protein KIN-7D, mitochondrial from Arabidopsis with 36.36% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT4G39050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434357.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;